SCOPe 2.04: Domain d4tyob_: 4tyo B:

Lineage for d4tyob_ (4tyo B:)

1. Root: SCOPe 2.04

2. Class d: Alpha and beta proteins (a+b) [53931] (380 folds)

3. Fold d.26: FKBP-like [54533] (3 superfamilies)
   core: beta(2)-alpha-beta(2); antiparallel beta-sheet

4. Superfamily d.26.1: FKBP-like [54534] (4 families)

5. Family d.26.1.1: FKBP immunophilin/proline isomerase [54535] (17 proteins)

6. Protein Mitotic rotamase PIN1, domain 2 [54547] (2 species)
   Domain 1 is a WW-domain

7. Species Human (Homo sapiens) [TaxId:9606] [54548] (39 PDB entries)

8. Domain d4tyob_: 4tyo B: [259111]
   automated match to d1j6ya_
   complexed with 39x, gol

Details for d4tyob_

PDB Entry: 4tyo, 1.75 Å

PDB Description: ppiase in complex with a non-phosphate small molecule inhibitor.

PDB Compounds: (B:) Peptidyl-prolyl cis-trans isomerase NIMA-interacting 1

SCOPe Domain Sequences for d4tyob_:

Sequence; same for both SEQRES and ATOM records:

>d4tyob_ d.26.1.1 (B:) Mitotic rotamase PIN1, domain 2 {Human (Homo sapiens) [TaxId: 9606]}
qgeparvrcshllvkhsqsrrpsswrqeqitrtqeealelingyiqkiksgeedfeslas
qfsdcssakargdlgafsrgqmqkpfedasfalrtgemsgpvftdsgihiilrte

Timeline for d4tyob_:

• d4tyob_ is new in SCOPe 2.04-stable
  
• d4tyob_ appears in SCOPe 2.05
  
• d4tyob_ appears in the current release, SCOPe 2.08