![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
![]() | Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
![]() | Protein Immunoglobulin heavy chain gamma constant domain 3, CH3-gamma [88589] (5 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [88590] (69 PDB entries) Uniprot P01857 #118-327 ! Uniprot P01857 118-327 # GC1_HUMAN Ig gamma-1 chain C region |
![]() | Domain d4q6yd2: 4q6y D:340-443 [259100] Other proteins in same PDB: d4q6ya1, d4q6yb1, d4q6yc1, d4q6yd1 automated match to d1hzhh4 |
PDB Entry: 4q6y (more details), 3 Å
SCOPe Domain Sequences for d4q6yd2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4q6yd2 b.1.1.2 (D:340-443) Immunoglobulin heavy chain gamma constant domain 3, CH3-gamma {Human (Homo sapiens) [TaxId: 9606]} kgqprepqvytlppsrdeltknqvsltclvkgfypsdiavewesngqpennykttppvld sdgsfflyskltvdksrwqqgnvfscsvmhealhnhytqkslsl
Timeline for d4q6yd2: