| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.60: SAM domain-like [47768] (17 superfamilies) 4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins |
Superfamily a.60.1: SAM/Pointed domain [47769] (4 families) ![]() |
| Family a.60.1.2: SAM (sterile alpha motif) domain [47773] (16 proteins) |
| Protein automated matches [190030] (2 species) not a true protein |
| Species Human (Homo sapiens) [TaxId:9606] [187366] (4 PDB entries) |
| Domain d4pzne_: 4pzn E: [259098] Other proteins in same PDB: d4pznc2 automated match to d1kw4a_ complexed with edo |
PDB Entry: 4pzn (more details), 2.3 Å
SCOPe Domain Sequences for d4pzne_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4pzne_ a.60.1.2 (E:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
epsiwtvddvwafihslpgcqdiadefraqeidgqallllkedhlmsamniklgpaekic
arinslk
Timeline for d4pzne_: