Lineage for d4pxhf1 (4pxh F:6-78)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2706108Fold a.28: Acyl carrier protein-like [47335] (3 superfamilies)
    4 helices, bundle; helix 3 is shorter than others; up-and-down
  4. 2706109Superfamily a.28.1: ACP-like [47336] (4 families) (S)
  5. 2706248Family a.28.1.0: automated matches [191582] (1 protein)
    not a true family
  6. 2706249Protein automated matches [191038] (29 species)
    not a true protein
  7. 2706380Species Streptomyces sp. [TaxId:1001349] [258245] (2 PDB entries)
  8. 2706383Domain d4pxhf1: 4pxh F:6-78 [259097]
    Other proteins in same PDB: d4pxha_, d4pxhb2, d4pxhc_, d4pxhd2, d4pxhe_, d4pxhf2
    automated match to d1dnya_
    complexed with hem, kh4

Details for d4pxhf1

PDB Entry: 4pxh (more details), 2.7 Å

PDB Description: Structure of P450sky (CYP163B3), a cytochrome P450 from skyllamycin biosynthesis in complex with a peptidyl carrier protein domain
PDB Compounds: (F:) Peptide synthetase

SCOPe Domain Sequences for d4pxhf1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4pxhf1 a.28.1.0 (F:6-78) automated matches {Streptomyces sp. [TaxId: 1001349]}
reprnetesrlrrifeevlhsedvdveanffelgghslqatklvsrirsefdaelplrdf
fehpnvaglavli

SCOPe Domain Coordinates for d4pxhf1:

Click to download the PDB-style file with coordinates for d4pxhf1.
(The format of our PDB-style files is described here.)

Timeline for d4pxhf1: