![]() | Class f: Membrane and cell surface proteins and peptides [56835] (59 folds) |
![]() | Fold f.23: Single transmembrane helix [81407] (42 superfamilies) not a true fold |
![]() | Superfamily f.23.26: PetG subunit of the cytochrome b6f complex [103446] (1 family) ![]() |
![]() | Family f.23.26.1: PetG subunit of the cytochrome b6f complex [103447] (2 proteins) |
![]() | Protein automated matches [196847] (1 species) not a true protein |
![]() | Species Mastigocladus laminosus [TaxId:83541] [196848] (5 PDB entries) |
![]() | Domain d4pv1g_: 4pv1 G: [259095] Other proteins in same PDB: d4pv1a_, d4pv1b_, d4pv1d1, d4pv1d2, d4pv1e_, d4pv1f_, d4pv1h_ automated match to d2e74g_ complexed with 7ph, 8k6, bcr, cd, cla, fes, hem, mys, opc, sma, sqd, umq |
PDB Entry: 4pv1 (more details), 3 Å
SCOPe Domain Sequences for d4pv1g_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4pv1g_ f.23.26.1 (G:) automated matches {Mastigocladus laminosus [TaxId: 83541]} mveplldglvlglvfatlgglfyaayqqykrpnelgg
Timeline for d4pv1g_: