Lineage for d4pv1f_ (4pv1 F:)

  1. Root: SCOPe 2.07
  2. 2575216Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)
  3. 2577985Fold f.23: Single transmembrane helix [81407] (42 superfamilies)
    not a true fold
  4. 2579085Superfamily f.23.25: PetM subunit of the cytochrome b6f complex [103441] (1 family) (S)
  5. 2579086Family f.23.25.1: PetM subunit of the cytochrome b6f complex [103442] (2 proteins)
  6. 2579087Protein PetM subunit of the cytochrome b6f complex [103443] (2 species)
  7. 2579090Species Mastigocladus laminosus [TaxId:83541] [103444] (9 PDB entries)
  8. 2579093Domain d4pv1f_: 4pv1 F: [259094]
    Other proteins in same PDB: d4pv1a_, d4pv1b_, d4pv1d1, d4pv1d2, d4pv1e_, d4pv1g_, d4pv1h_
    automated match to d1vf5s_
    complexed with 7ph, 8k6, bcr, cd, cla, fes, hem, mys, opc, sma, sqd, umq

Details for d4pv1f_

PDB Entry: 4pv1 (more details), 3 Å

PDB Description: cytochrome b6f structure from m. laminosus with the quinone analog inhibitor stigmatellin
PDB Compounds: (F:) Cytochrome b6-f complex subunit 7

SCOPe Domain Sequences for d4pv1f_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4pv1f_ f.23.25.1 (F:) PetM subunit of the cytochrome b6f complex {Mastigocladus laminosus [TaxId: 83541]}
teemlyaallsfglifvgwglgvlllkiqga

SCOPe Domain Coordinates for d4pv1f_:

Click to download the PDB-style file with coordinates for d4pv1f_.
(The format of our PDB-style files is described here.)

Timeline for d4pv1f_: