Lineage for d4pv1d1 (4pv1 D:9-45)

  1. Root: SCOPe 2.04
  2. 1695624Class f: Membrane and cell surface proteins and peptides [56835] (57 folds)
  3. 1697651Fold f.23: Single transmembrane helix [81407] (38 superfamilies)
    not a true fold
  4. 1698284Superfamily f.23.12: ISP transmembrane anchor [81502] (2 families) (S)
  5. 1698334Family f.23.12.0: automated matches [254198] (1 protein)
    not a true family
  6. 1698335Protein automated matches [254432] (4 species)
    not a true protein
  7. 1698340Species Mastigocladus laminosus [TaxId:83541] [255131] (3 PDB entries)
  8. 1698343Domain d4pv1d1: 4pv1 D:9-45 [259092]
    Other proteins in same PDB: d4pv1a_, d4pv1b_, d4pv1d2, d4pv1e_, d4pv1f_, d4pv1g_, d4pv1h_
    automated match to d2e76d2
    complexed with 7ph, 8k6, bcr, cd, cla, fes, hem, mys, opc, sma, sqd, umq

Details for d4pv1d1

PDB Entry: 4pv1 (more details), 3 Å

PDB Description: cytochrome b6f structure from m. laminosus with the quinone analog inhibitor stigmatellin
PDB Compounds: (D:) Cytochrome b6-f complex iron-sulfur subunit

SCOPe Domain Sequences for d4pv1d1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4pv1d1 f.23.12.0 (D:9-45) automated matches {Mastigocladus laminosus [TaxId: 83541]}
dvpdmgrrqfmnllafgtvtgvalgalyplvkyfipp

SCOPe Domain Coordinates for d4pv1d1:

Click to download the PDB-style file with coordinates for d4pv1d1.
(The format of our PDB-style files is described here.)

Timeline for d4pv1d1: