Lineage for d4pv1a_ (4pv1 A:)

  1. Root: SCOPe 2.06
  2. 2250849Class f: Membrane and cell surface proteins and peptides [56835] (59 folds)
  3. 2253332Fold f.21: Heme-binding four-helical bundle [81344] (3 superfamilies)
    core: four transmembrane helices, up-and-down bundle, binds one or two heme groups in between the helices
  4. 2253333Superfamily f.21.1: Transmembrane di-heme cytochromes [81342] (2 families) (S)
    Three of the four heme-ligands are conserved between the two families; both heme groups bind similarly but not identically
  5. 2253339Family f.21.1.2: Cytochrome b of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81642] (3 proteins)
    a part (domain) of a larger mitochondrial cytochrome b subunit, separate subunit in plants and cyanobacteria
  6. 2253395Protein automated matches [196844] (6 species)
    not a true protein
  7. 2253409Species Mastigocladus laminosus [TaxId:83541] [196845] (5 PDB entries)
  8. 2253412Domain d4pv1a_: 4pv1 A: [259089]
    Other proteins in same PDB: d4pv1b_, d4pv1d1, d4pv1d2, d4pv1e_, d4pv1f_, d4pv1g_, d4pv1h_
    automated match to d2e74a_
    complexed with 7ph, 8k6, bcr, cd, cla, fes, hem, mys, opc, sma, sqd, umq

Details for d4pv1a_

PDB Entry: 4pv1 (more details), 3 Å

PDB Description: cytochrome b6f structure from m. laminosus with the quinone analog inhibitor stigmatellin
PDB Compounds: (A:) Cytochrome b6

SCOPe Domain Sequences for d4pv1a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4pv1a_ f.21.1.2 (A:) automated matches {Mastigocladus laminosus [TaxId: 83541]}
nvydwfqerleiqaladdvtskyvpphvnifyclggitltcfliqfatgfamtfyykptv
teayasvqyimnevsfgwlirsihrwsasmmvlmmilhvfrvyltggfkkpreltwisgv
ilavitvsfgvtgyslpwdqvgywavkivsgvpeaipvvgvlisdllrggssvgqatltr
yysahtfvlpwliavfmllhflmirkqgisgpl

SCOPe Domain Coordinates for d4pv1a_:

Click to download the PDB-style file with coordinates for d4pv1a_.
(The format of our PDB-style files is described here.)

Timeline for d4pv1a_: