![]() | Class f: Membrane and cell surface proteins and peptides [56835] (69 folds) |
![]() | Fold f.21: Heme-binding four-helical bundle [81344] (3 superfamilies) core: four transmembrane helices, up-and-down bundle, binds one or two heme groups in between the helices |
![]() | Superfamily f.21.1: Transmembrane di-heme cytochromes [81342] (2 families) ![]() Three of the four heme-ligands are conserved between the two families; both heme groups bind similarly but not identically |
![]() | Family f.21.1.2: Cytochrome b of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81642] (3 proteins) a part (domain) of a larger mitochondrial cytochrome b subunit, separate subunit in plants and cyanobacteria |
![]() | Protein automated matches [196844] (6 species) not a true protein |
![]() | Species Mastigocladus laminosus [TaxId:83541] [196845] (5 PDB entries) |
![]() | Domain d4pv1a_: 4pv1 A: [259089] Other proteins in same PDB: d4pv1b_, d4pv1d1, d4pv1d2, d4pv1e_, d4pv1f_, d4pv1g_, d4pv1h_ automated match to d2e74a_ complexed with 7ph, 8k6, bcr, cd, cla, fes, hec, mys, opc, sma, sqd, umq |
PDB Entry: 4pv1 (more details), 3 Å
SCOPe Domain Sequences for d4pv1a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4pv1a_ f.21.1.2 (A:) automated matches {Mastigocladus laminosus [TaxId: 83541]} nvydwfqerleiqaladdvtskyvpphvnifyclggitltcfliqfatgfamtfyykptv teayasvqyimnevsfgwlirsihrwsasmmvlmmilhvfrvyltggfkkpreltwisgv ilavitvsfgvtgyslpwdqvgywavkivsgvpeaipvvgvlisdllrggssvgqatltr yysahtfvlpwliavfmllhflmirkqgisgpl
Timeline for d4pv1a_: