SCOPe 2.08: Domain d4pv1a_: 4pv1 A:

Lineage for d4pv1a_ (4pv1 A:)

1. Root: SCOPe 2.08

2. Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)

3. Fold f.21: Heme-binding four-helical bundle [81344] (3 superfamilies)
   core: four transmembrane helices, up-and-down bundle, binds one or two heme groups in between the helices

4. Superfamily f.21.1: Transmembrane di-heme cytochromes [81342] (2 families)
   Three of the four heme-ligands are conserved between the two families; both heme groups bind similarly but not identically

5. Family f.21.1.2: Cytochrome b of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81642] (3 proteins)
   a part (domain) of a larger mitochondrial cytochrome b subunit, separate subunit in plants and cyanobacteria

6. Protein automated matches [196844] (6 species)
   not a true protein

7. Species Mastigocladus laminosus [TaxId:83541] [196845] (5 PDB entries)

8. Domain d4pv1a_: 4pv1 A: [259089]
   Other proteins in same PDB: d4pv1b_, d4pv1d1, d4pv1d2, d4pv1e_, d4pv1f_, d4pv1g_, d4pv1h_
   automated match to d2e74a_
   complexed with 7ph, 8k6, bcr, cd, cla, fes, hec, mys, opc, sma, sqd, umq

Details for d4pv1a_

PDB Entry: 4pv1, 3 Å

PDB Description: cytochrome b6f structure from m. laminosus with the quinone analog inhibitor stigmatellin

PDB Compounds: (A:) Cytochrome b6

SCOPe Domain Sequences for d4pv1a_:

Sequence; same for both SEQRES and ATOM records:

>d4pv1a_ f.21.1.2 (A:) automated matches {Mastigocladus laminosus [TaxId: 83541]}
nvydwfqerleiqaladdvtskyvpphvnifyclggitltcfliqfatgfamtfyykptv
teayasvqyimnevsfgwlirsihrwsasmmvlmmilhvfrvyltggfkkpreltwisgv
ilavitvsfgvtgyslpwdqvgywavkivsgvpeaipvvgvlisdllrggssvgqatltr
yysahtfvlpwliavfmllhflmirkqgisgpl

Timeline for d4pv1a_:

• d4pv1a_ first appeared in SCOPe 2.04
  
• d4pv1a_ appears in SCOPe 2.07