Class a: All alpha proteins [46456] (290 folds) |
Fold a.39: EF Hand-like [47472] (4 superfamilies) core: 4 helices; array of 2 hairpins, opened |
Superfamily a.39.1: EF-hand [47473] (12 families) Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop |
Family a.39.1.8: Penta-EF-hand proteins [63550] (7 proteins) |
Protein Calpain small (regulatory) subunit (domain VI) [47552] (3 species) |
Species Human (Homo sapiens) [TaxId:9606] [47553] (10 PDB entries) |
Domain d4phjb_: 4phj B: [259088] automated match to d1kfxs_ complexed with ca |
PDB Entry: 4phj (more details), 1.6 Å
SCOPe Domain Sequences for d4phjb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4phjb_ a.39.1.8 (B:) Calpain small (regulatory) subunit (domain VI) {Human (Homo sapiens) [TaxId: 9606]} eevrqfrrlfaqlagddmevsatelmnilnkvvtrhpdlktdgfgidtcrsmvavmdsdt tgklgfeefkylwnnikrwqaiykqfdtdrsgticsselpgafeaagfhlnehlynmiir rysdesgnmdfdnfisclvrldamfrafksldkdgtgqiqvniqewlqltmys
Timeline for d4phjb_: