SCOPe 2.08: Domain d4phjb_: 4phj B:

Lineage for d4phjb_ (4phj B:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.39: EF Hand-like [47472] (4 superfamilies)
   core: 4 helices; array of 2 hairpins, opened

4. Superfamily a.39.1: EF-hand [47473] (12 families)
   Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop

5. Family a.39.1.8: Penta-EF-hand proteins [63550] (7 proteins)

6. Protein Calpain small (regulatory) subunit (domain VI) [47552] (3 species)

7. Species Human (Homo sapiens) [TaxId:9606] [47553] (10 PDB entries)

8. Domain d4phjb_: 4phj B: [259088]
   automated match to d1kfxs_
   complexed with ca

Details for d4phjb_

PDB Entry: 4phj, 1.6 Å

PDB Description: The Structural Basis of Differential Inhibition of Human Calpain by Indole and Phenyl alpha-Mercaptoacrylic Acids: Human unliganded protein

PDB Compounds: (B:) Calpain small subunit 1

SCOPe Domain Sequences for d4phjb_:

Sequence; same for both SEQRES and ATOM records:

>d4phjb_ a.39.1.8 (B:) Calpain small (regulatory) subunit (domain VI) {Human (Homo sapiens) [TaxId: 9606]}
eevrqfrrlfaqlagddmevsatelmnilnkvvtrhpdlktdgfgidtcrsmvavmdsdt
tgklgfeefkylwnnikrwqaiykqfdtdrsgticsselpgafeaagfhlnehlynmiir
rysdesgnmdfdnfisclvrldamfrafksldkdgtgqiqvniqewlqltmys

Timeline for d4phjb_:

• d4phjb_ first appeared in SCOPe 2.04
  
• d4phjb_ appears in SCOPe 2.07