Lineage for d4oeaa_ (4oea A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2008476Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily)
    multihelical; 3 layers or orthogonally packed helices
  4. 2008477Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (2 families) (S)
  5. 2008478Family a.123.1.1: Nuclear receptor ligand-binding domain [48509] (34 protein domains)
  6. 2008479Protein Androgen receptor [63621] (4 species)
  7. 2008489Species Human (Homo sapiens) [TaxId:9606] [63623] (62 PDB entries)
    Uniprot P10275 671-919
  8. 2008535Domain d4oeaa_: 4oea A: [259083]
    automated match to d2pnua_
    complexed with dht

Details for d4oeaa_

PDB Entry: 4oea (more details), 2.12 Å

PDB Description: Crystal structure of AR-LBD
PDB Compounds: (A:) Androgen receptor

SCOPe Domain Sequences for d4oeaa_:

Sequence, based on SEQRES records: (download)

>d4oeaa_ a.123.1.1 (A:) Androgen receptor {Human (Homo sapiens) [TaxId: 9606]}
qpiflnvleaiepgvvcaghdnnqpdsfaallsslnelgerqlvhvvkwakalpgfrnlh
vddqmaviqyswmglmvfamgwrsftnvnsamlyfapdlvfneyrmhksrmysqcvrmrh
lsqefgwlqitpqeflcmkalllfsiipvdglknqkffdelrmnyikeldriiackrknp
tscsrrfyqltklldsvqpiarelhqftfdllikshmvsvdfpemmaeiisvqvpkilsg
kvkpiyfht

Sequence, based on observed residues (ATOM records): (download)

>d4oeaa_ a.123.1.1 (A:) Androgen receptor {Human (Homo sapiens) [TaxId: 9606]}
qpiflnvleaiepgvvcaghdnnqpdsfaallsslnelgerqlvhvvkwakalpgfrnlh
vddqmaviqyswmglmvfamgwrsftnvnsamlyfapdlvfneyrmhksrmysqcvrmrh
lsqefgwlqitpqeflcmkalllfsiipvdglknqkffdelrmnyikeldriiascsrrf
yqltklldsvqpiarelhqftfdllikshmvsvdfpemmaeiisvqvpkilsgkvkpiyf
ht

SCOPe Domain Coordinates for d4oeaa_:

Click to download the PDB-style file with coordinates for d4oeaa_.
(The format of our PDB-style files is described here.)

Timeline for d4oeaa_: