SCOPe 2.05: Domain d4mmgb_: 4mmg B:

Lineage for d4mmgb_ (4mmg B:)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.298: RelE-like [143010] (1 superfamily)
   beta-alpha(2)-beta(4), 2 layers; a/b, antiparallel beta-sheet; order 15432

4. Superfamily d.298.1: RelE-like [143011] (3 families)
   Toxin component of plasmid stabilisation system

5. Family d.298.1.0: automated matches [191658] (1 protein)
   not a true family

6. Protein automated matches [191236] (5 species)
   not a true protein

7. Species Escherichia coli [TaxId:83333] [257085] (4 PDB entries)

8. Domain d4mmgb_: 4mmg B: [259073]
   automated match to d2otra_
   complexed with so4; mutant

Details for d4mmgb_

PDB Entry: 4mmg, 1.5 Å

PDB Description: crystal structure of yafq mutant h87q from e.coli

PDB Compounds: (B:) mRNA interferase YafQ

SCOPe Domain Sequences for d4mmgb_:

Sequence; same for both SEQRES and ATOM records:

>d4mmgb_ d.298.1.0 (B:) automated matches {Escherichia coli [TaxId: 83333]}
qrdieysgqyskdvklaqkrhkdmnklkylmtllinntlplpavykdhplqgswkgyrda
hvepdwiliykltdkllrfertgtqaalfg

Timeline for d4mmgb_:

• d4mmgb_ first appeared in SCOPe 2.04
  
• d4mmgb_ appears in SCOPe 2.06
  
• d4mmgb_ appears in the current release, SCOPe 2.08