Lineage for d2mbxa_ (2mbx A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2710066Fold a.39: EF Hand-like [47472] (4 superfamilies)
    core: 4 helices; array of 2 hairpins, opened
  4. 2710067Superfamily a.39.1: EF-hand [47473] (12 families) (S)
    Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop
  5. 2711591Family a.39.1.0: automated matches [191396] (1 protein)
    not a true family
  6. 2711592Protein automated matches [190513] (36 species)
    not a true protein
  7. 2711595Species Atlantic cod (Gadus morhua) [TaxId:8049] [259070] (1 PDB entry)
  8. 2711596Domain d2mbxa_: 2mbx A: [259071]
    automated match to d1ttxa_
    complexed with ca

Details for d2mbxa_

PDB Entry: 2mbx (more details)

PDB Description: Structure, dynamics and stability of allergen cod parvalbumin Gad m 1 by solution and high-pressure NMR.
PDB Compounds: (A:) Parvalbumin beta

SCOPe Domain Sequences for d2mbxa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2mbxa_ a.39.1.0 (A:) automated matches {Atlantic cod (Gadus morhua) [TaxId: 8049]}
mafagilndaditaalaackaegsfdhkafftkvglaakspadikkvfeiidqdksdfve
edelklflqnfsagaralsdaetkvflkagdsdgdgkigvdefgamika

SCOPe Domain Coordinates for d2mbxa_:

Click to download the PDB-style file with coordinates for d2mbxa_.
(The format of our PDB-style files is described here.)

Timeline for d2mbxa_: