![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.38: Thioesterase/thiol ester dehydrase-isomerase [54636] (1 superfamily) core: beta-alpha-beta(4); 2 layers: alpha/beta |
![]() | Superfamily d.38.1: Thioesterase/thiol ester dehydrase-isomerase [54637] (10 families) ![]() |
![]() | Family d.38.1.5: PaaI/YdiI-like [89902] (15 proteins) |
![]() | Protein Hypothetical protein YdiI [102910] (1 species) |
![]() | Species Escherichia coli [TaxId:562] [102911] (6 PDB entries) |
![]() | Domain d4k4bc_: 4k4b C: [259069] automated match to d1sbka_ complexed with cl, uoq |
PDB Entry: 4k4b (more details), 1.9 Å
SCOPe Domain Sequences for d4k4bc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4k4bc_ d.38.1.5 (C:) Hypothetical protein YdiI {Escherichia coli [TaxId: 562]} miwkrkitlealnamgegnmvgfldirfehigddtleatmpvdsrtkqpfgllhggasvv laesigsvagylctegeqkvvgleinanhvrsaregrvrgvckplhlgsrhqvwqieifd ekgrlccssrlttail
Timeline for d4k4bc_: