Lineage for d4ii4b1 (4ii4 B:2-239)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2700837Fold a.25: Ferritin-like [47239] (6 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 2700838Superfamily a.25.1: Ferritin-like [47240] (10 families) (S)
    contains bimetal-ion centre in the middle of the bundle
  5. 2703310Family a.25.1.2: Ribonucleotide reductase-like [47253] (9 proteins)
  6. 2703608Protein automated matches [190435] (12 species)
    not a true protein
  7. 2703653Species Escherichia coli [TaxId:511145] [189613] (7 PDB entries)
  8. 2703672Domain d4ii4b1: 4ii4 B:2-239 [259066]
    Other proteins in same PDB: d4ii4b2, d4ii4c2
    automated match to d3pvtc_
    complexed with byc; mutant

Details for d4ii4b1

PDB Entry: 4ii4 (more details), 2.8 Å

PDB Description: the phenylacetyl-coa monooxygenase - mutant paaa e49q k68q - paac wild type subcomplex with benzoyl-coa
PDB Compounds: (B:) 1,2-phenylacetyl-CoA epoxidase, subunit C

SCOPe Domain Sequences for d4ii4b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4ii4b1 a.25.1.2 (B:2-239) automated matches {Escherichia coli [TaxId: 511145]}
nqltaytlrlgdnclvlsqrlgewcghapeleidlalanigldllgqarnflsyaaelag
egdedtlaftrderqfsnlllveqpngnfadtiarqyfidawhvalftrlmesrdpqlaa
isakaikearyhlrfsrgwlerlgngtdvsgqkmqqainklwrftaelfdadeidialse
egiavdprtlraaweaevfagineatlnvpqeqayrtggkkglhtehlgpmlaemqyl

SCOPe Domain Coordinates for d4ii4b1:

Click to download the PDB-style file with coordinates for d4ii4b1.
(The format of our PDB-style files is described here.)

Timeline for d4ii4b1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4ii4b2