Lineage for d4ifja_ (4ifj A:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2417088Fold b.68: 6-bladed beta-propeller [50938] (11 superfamilies)
    consists of six 4-stranded beta-sheet motifs; meander
  4. 2418094Superfamily b.68.11: Kelch motif [117281] (2 families) (S)
  5. 2418095Family b.68.11.1: Kelch motif [117282] (2 proteins)
    Pfam PF01344; sequence motif corresponding to one beta-sheet blade; similar sequences are found in the Galactose oxidase 7-bladed beta-propeller domain (50967)
  6. 2418104Protein automated matches [190126] (2 species)
    not a true protein
  7. 2418105Species Human (Homo sapiens) [TaxId:9606] [193097] (25 PDB entries)
  8. 2418115Domain d4ifja_: 4ifj A: [259065]
    automated match to d4in4c_

Details for d4ifja_

PDB Entry: 4ifj (more details), 1.8 Å

PDB Description: Crystal Structures of apo Keap1, Keap1-peptide, and Keap1-compound complexes
PDB Compounds: (A:) Kelch-like ECH-associated protein 1

SCOPe Domain Sequences for d4ifja_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4ifja_ b.68.11.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
pkvgrliytaggyfrqslsyleaynpsdgtwlrladlqvprsglagcvvggllyavggrn
nspdgntdssaldcynpmtnqwspcapmsvprnrigvgvidghiyavggshgcihhnsve
ryeperdewhlvapmltrrigvgvavlnrllyavggfdgtnrlnsaecyypernewrmit
amntirsgagvcvlhnciyaaggydgqdqlnsverydvetetwtfvapmkhrrsalgitv
hqgriyvlggydghtfldsvecydpdtdtwsevtrmtsgrsgvgvavt

SCOPe Domain Coordinates for d4ifja_:

Click to download the PDB-style file with coordinates for d4ifja_.
(The format of our PDB-style files is described here.)

Timeline for d4ifja_: