SCOPe 2.05: Domain d4cvra_: 4cvr A:

Lineage for d4cvra_ (4cvr A:)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.25: Ferritin-like [47239] (6 superfamilies)
   core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection

4. Superfamily a.25.1: Ferritin-like [47240] (10 families)
   contains bimetal-ion centre in the middle of the bundle

5. Family a.25.1.1: Ferritin [47241] (10 proteins)

6. Protein automated matches [190041] (24 species)
   not a true protein

7. Species Escherichia coli [TaxId:562] [259060] (4 PDB entries)

8. Domain d4cvra_: 4cvr A: [259063]
   automated match to d3e1ja_
   complexed with zn

Details for d4cvra_

PDB Entry: 4cvr, 1.1 Å

PDB Description: Structure of Apobacterioferritin Y25F variant

PDB Compounds: (A:) bacterioferritin

SCOPe Domain Sequences for d4cvra_:

Sequence; same for both SEQRES and ATOM records:

>d4cvra_ a.25.1.1 (A:) automated matches {Escherichia coli [TaxId: 562]}
mkgdtkvinylnkllgnelvainqfflharmfknwglkrlndveyresidemkhadryie
rilfleglpnlqdlgklnigedveemlrsdlaleldgaknlreaigyadsvrdyvsrdmm
ieilrdeeghidwleteldliqkmglqnylqaqire

Timeline for d4cvra_:

• d4cvra_ first appeared in SCOPe 2.04
  
• d4cvra_ appears in SCOPe 2.06
  
• d4cvra_ appears in the current release, SCOPe 2.08