SCOPe 2.08: Domain d4cvpa1: 4cvp A:1-154

Lineage for d4cvpa1 (4cvp A:1-154)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.25: Ferritin-like [47239] (6 superfamilies)
   core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection

4. Superfamily a.25.1: Ferritin-like [47240] (10 families)
   contains bimetal-ion centre in the middle of the bundle

5. Family a.25.1.1: Ferritin [47241] (10 proteins)

6. Protein automated matches [190041] (34 species)
   not a true protein

7. Species Escherichia coli [TaxId:562] [259060] (4 PDB entries)

8. Domain d4cvpa1: 4cvp A:1-154 [259062]
   Other proteins in same PDB: d4cvpa2
   automated match to d3e1ja_
   complexed with fe

Details for d4cvpa1

PDB Entry: 4cvp, 2.11 Å

PDB Description: Structure of Apobacterioferritin

PDB Compounds: (A:) bacterioferritin

SCOPe Domain Sequences for d4cvpa1:

Sequence; same for both SEQRES and ATOM records:

>d4cvpa1 a.25.1.1 (A:1-154) automated matches {Escherichia coli [TaxId: 562]}
mkgdtkvinylnkllgnelvainqyflharmfknwglkrlndveyresidemkhadryie
rilfleglpnlqdlgklnigedveemlrsdlaleldgaknlreaigyadsvrdyvsrdmm
ieilrdeeghidwleteldliqkmglqnylqaqi

Timeline for d4cvpa1:

• d4cvpa1 first appeared in SCOPe 2.04, called d4cvpa_
  
• d4cvpa1 appears in SCOPe 2.07