Lineage for d4cvpa1 (4cvp A:1-154)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2700837Fold a.25: Ferritin-like [47239] (6 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 2700838Superfamily a.25.1: Ferritin-like [47240] (10 families) (S)
    contains bimetal-ion centre in the middle of the bundle
  5. 2700839Family a.25.1.1: Ferritin [47241] (10 proteins)
  6. 2702255Protein automated matches [190041] (34 species)
    not a true protein
  7. 2702463Species Escherichia coli [TaxId:562] [259060] (4 PDB entries)
  8. 2702467Domain d4cvpa1: 4cvp A:1-154 [259062]
    Other proteins in same PDB: d4cvpa2
    automated match to d3e1ja_
    complexed with fe

Details for d4cvpa1

PDB Entry: 4cvp (more details), 2.11 Å

PDB Description: Structure of Apobacterioferritin
PDB Compounds: (A:) bacterioferritin

SCOPe Domain Sequences for d4cvpa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4cvpa1 a.25.1.1 (A:1-154) automated matches {Escherichia coli [TaxId: 562]}
mkgdtkvinylnkllgnelvainqyflharmfknwglkrlndveyresidemkhadryie
rilfleglpnlqdlgklnigedveemlrsdlaleldgaknlreaigyadsvrdyvsrdmm
ieilrdeeghidwleteldliqkmglqnylqaqi

SCOPe Domain Coordinates for d4cvpa1:

Click to download the PDB-style file with coordinates for d4cvpa1.
(The format of our PDB-style files is described here.)

Timeline for d4cvpa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4cvpa2