![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.25: Ferritin-like [47239] (6 superfamilies) core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection |
![]() | Superfamily a.25.1: Ferritin-like [47240] (10 families) ![]() contains bimetal-ion centre in the middle of the bundle |
![]() | Family a.25.1.1: Ferritin [47241] (10 proteins) |
![]() | Protein automated matches [190041] (34 species) not a true protein |
![]() | Species Escherichia coli [TaxId:562] [259060] (4 PDB entries) |
![]() | Domain d4cvta1: 4cvt A:1-156 [259061] Other proteins in same PDB: d4cvta2 automated match to d3e1ja_ complexed with zn |
PDB Entry: 4cvt (more details), 1.79 Å
SCOPe Domain Sequences for d4cvta1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4cvta1 a.25.1.1 (A:1-156) automated matches {Escherichia coli [TaxId: 562]} mkgdtkvinylnkllgnelvainqyflharmfknwglkrlndveyresidemkhadrfie rilfleglpnlqdlgklnigedveemlrsdlaleldgaknlreaigyadsvrdyvsrdmm ieilrdeeghidwleteldliqkmglqnylqaqire
Timeline for d4cvta1: