Lineage for d4cvta1 (4cvt A:1-156)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2700837Fold a.25: Ferritin-like [47239] (6 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 2700838Superfamily a.25.1: Ferritin-like [47240] (10 families) (S)
    contains bimetal-ion centre in the middle of the bundle
  5. 2700839Family a.25.1.1: Ferritin [47241] (10 proteins)
  6. 2702255Protein automated matches [190041] (34 species)
    not a true protein
  7. 2702463Species Escherichia coli [TaxId:562] [259060] (4 PDB entries)
  8. 2702466Domain d4cvta1: 4cvt A:1-156 [259061]
    Other proteins in same PDB: d4cvta2
    automated match to d3e1ja_
    complexed with zn

Details for d4cvta1

PDB Entry: 4cvt (more details), 1.79 Å

PDB Description: Structure of Apobacterioferritin Y58F variant
PDB Compounds: (A:) bacterioferritin

SCOPe Domain Sequences for d4cvta1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4cvta1 a.25.1.1 (A:1-156) automated matches {Escherichia coli [TaxId: 562]}
mkgdtkvinylnkllgnelvainqyflharmfknwglkrlndveyresidemkhadrfie
rilfleglpnlqdlgklnigedveemlrsdlaleldgaknlreaigyadsvrdyvsrdmm
ieilrdeeghidwleteldliqkmglqnylqaqire

SCOPe Domain Coordinates for d4cvta1:

Click to download the PDB-style file with coordinates for d4cvta1.
(The format of our PDB-style files is described here.)

Timeline for d4cvta1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4cvta2