SCOPe 2.04: Domain d3wjab1: 3wja B:18-279

Lineage for d3wjab1 (3wja B:18-279)

1. Root: SCOPe 2.04

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.58: Aminoacid dehydrogenase-like, N-terminal domain [53222] (1 superfamily)
   core: 3 layers: a/b/a; parallel beta-sheet of 4 strands; 2134

4. Superfamily c.58.1: Aminoacid dehydrogenase-like, N-terminal domain [53223] (6 families)

5. Family c.58.1.0: automated matches [227157] (1 protein)
   not a true family

6. Protein automated matches [226864] (21 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [225016] (2 PDB entries)

8. Domain d3wjab1: 3wja B:18-279 [259044]
   Other proteins in same PDB: d3wjab2
   automated match to d1gq2a2

Details for d3wjab1

PDB Entry: 3wja, 2.55 Å

PDB Description: the crystal structure of human cytosolic nadp(+)-dependent malic enzyme in apo form

PDB Compounds: (B:) NADP-dependent malic enzyme

SCOPe Domain Sequences for d3wjab1:

Sequence; same for both SEQRES and ATOM records:

>d3wjab1 c.58.1.0 (B:18-279) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rrhthqrgylltrnphlnkdlaftleerqqlnihgllppsfnsqeiqvlrvvknfehlns
dfdrylllmdlqdrneklfyrvltsdiekfmpivytptvglacqqyslvfrkprglfiti
hdrghiasvlnawpedvikaivvtdgerilglgdlgcngmgipvgklalytacggmnpqe
clpvildvgteneellkdplyiglrqrrvrgseyddfldefmeavsskygmncliqfedf
anvnafrllnkyrnqyctfndd

Timeline for d3wjab1:

• d3wjab1 is new in SCOPe 2.04-stable
  
• d3wjab1 appears in SCOPe 2.05
  
• d3wjab1 appears in the current release, SCOPe 2.08