Lineage for d3wjab1 (3wja B:18-279)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2127441Fold c.58: Aminoacid dehydrogenase-like, N-terminal domain [53222] (1 superfamily)
    core: 3 layers: a/b/a; parallel beta-sheet of 4 strands; 2134
  4. 2127442Superfamily c.58.1: Aminoacid dehydrogenase-like, N-terminal domain [53223] (6 families) (S)
  5. 2127755Family c.58.1.0: automated matches [227157] (1 protein)
    not a true family
  6. 2127756Protein automated matches [226864] (29 species)
    not a true protein
  7. 2127835Species Human (Homo sapiens) [TaxId:9606] [225016] (3 PDB entries)
  8. 2127840Domain d3wjab1: 3wja B:18-279 [259044]
    Other proteins in same PDB: d3wjaa2, d3wjab2
    automated match to d1gq2a2

Details for d3wjab1

PDB Entry: 3wja (more details), 2.55 Å

PDB Description: The crystal structure of human cytosolic NADP(+)-dependent malic enzyme in apo form
PDB Compounds: (B:) NADP-dependent malic enzyme

SCOPe Domain Sequences for d3wjab1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3wjab1 c.58.1.0 (B:18-279) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rrhthqrgylltrnphlnkdlaftleerqqlnihgllppsfnsqeiqvlrvvknfehlns
dfdrylllmdlqdrneklfyrvltsdiekfmpivytptvglacqqyslvfrkprglfiti
hdrghiasvlnawpedvikaivvtdgerilglgdlgcngmgipvgklalytacggmnpqe
clpvildvgteneellkdplyiglrqrrvrgseyddfldefmeavsskygmncliqfedf
anvnafrllnkyrnqyctfndd

SCOPe Domain Coordinates for d3wjab1:

Click to download the PDB-style file with coordinates for d3wjab1.
(The format of our PDB-style files is described here.)

Timeline for d3wjab1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3wjab2