SCOPe 2.05: Domain d4uo3c_: 4uo3 C:

Lineage for d4uo3c_ (4uo3 C:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.19: Viral protein domain [49817] (1 superfamily)
   sandwich; 9 strands in 2 sheets; jelly-roll; form trimers

4. Superfamily b.19.1: Viral protein domain [49818] (4 families)
   forms homotrimers

5. Family b.19.1.2: Influenza hemagglutinin headpiece [49823] (2 proteins)

6. Protein automated matches [190291] (24 species)
   not a true protein

7. Species Influenza a virus [TaxId:560387] [258567] (1 PDB entry)

8. Domain d4uo3c_: 4uo3 C: [259042]
   Other proteins in same PDB: d4uo3b_, d4uo3d_, d4uo3f_
   automated match to d3hmga_
   complexed with edo, nag; mutant

Details for d4uo3c_

PDB Entry: 4uo3, 2.87 Å

PDB Description: structure of the a_equine_richmond_07 h3 haemagglutinin mutant ser30thr

PDB Compounds: (C:) h3 haemagglutinin ha1 chain

SCOPe Domain Sequences for d4uo3c_:

Sequence; same for both SEQRES and ATOM records:

>d4uo3c_ b.19.1.2 (C:) automated matches {Influenza a virus [TaxId: 560387]}
nnntatlclghhavangtlvktitddqievtnatelvqsismgkicnnsyrildgrnctl
idamlgdphcdvfqyenwdlfierssafsncypydipdyaslrsivassgtleftaegft
wtgvtqngrsgackrgsadsffsrlnwltksgnsyptlnvtmpnnknfdklyiwgihhps
snqeqtklyiqesgrvtvstkrsqqtiipnigsrpwvrgqsgrisiywtivkpgdilmin
sngnlvaprgyfklktgkssvmrsdvpidicvsecitpngsisnekpfqnvnkvtygkcp
kyirqntlklatgmrnvpek

Timeline for d4uo3c_:

• d4uo3c_ first appeared in SCOPe 2.04
  
• d4uo3c_ appears in SCOPe 2.06
  
• d4uo3c_ appears in the current release, SCOPe 2.08