| Class h: Coiled coil proteins [57942] (7 folds) |
| Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies) core: trimeric coiled coil |
Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families) ![]() |
| Family h.3.1.1: Influenza hemagglutinin (stalk) [58065] (2 proteins) |
| Protein automated matches [254646] (33 species) not a true protein |
| Species Influenza a virus (a/equine/richmond/1/2007)(h3n8)) [TaxId:560387] [258556] (3 PDB entries) |
| Domain d4uo1f_: 4uo1 F: [259039] Other proteins in same PDB: d4uo1a_, d4uo1c_, d4uo1e_ automated match to d3vund_ complexed with fuc, nag |
PDB Entry: 4uo1 (more details), 3 Å
SCOPe Domain Sequences for d4uo1f_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4uo1f_ h.3.1.1 (F:) automated matches {Influenza a virus (a/equine/richmond/1/2007)(h3n8)) [TaxId: 560387]}
gifgaiagfiengwegmvdgwygfryqnsegtgqaadlkstqtaidqineklnrviertn
ekfhqiekefsevegriqdlekyvedtkidlwsynaellvalenqhtidltdaemnklfe
ktrrqlrenaedmgggcfkiyhkcdnacigsirngtydhyiyrdealnnrfq
Timeline for d4uo1f_: