Lineage for d4uo1f_ (4uo1 F:)

  1. Root: SCOPe 2.07
  2. 2590057Class h: Coiled coil proteins [57942] (7 folds)
  3. 2591558Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)
    core: trimeric coiled coil
  4. 2591559Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families) (S)
  5. 2591560Family h.3.1.1: Influenza hemagglutinin (stalk) [58065] (2 protein domains)
  6. 2592030Protein automated matches [254646] (28 species)
    not a true protein
  7. 2592046Species Influenza A virus (a/equine/richmond/1/2007)(h3n8)) [TaxId:560387] [258556] (3 PDB entries)
  8. 2592055Domain d4uo1f_: 4uo1 F: [259039]
    Other proteins in same PDB: d4uo1a_, d4uo1c_, d4uo1e_
    automated match to d3vund_
    complexed with fuc, nag

Details for d4uo1f_

PDB Entry: 4uo1 (more details), 3 Å

PDB Description: Structure of the A_Equine_Richmond_07 H3 haemagglutinin in complex with 3SLN
PDB Compounds: (F:) Hemagglutinin

SCOPe Domain Sequences for d4uo1f_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4uo1f_ h.3.1.1 (F:) automated matches {Influenza A virus (a/equine/richmond/1/2007)(h3n8)) [TaxId: 560387]}
gifgaiagfiengwegmvdgwygfryqnsegtgqaadlkstqtaidqineklnrviertn
ekfhqiekefsevegriqdlekyvedtkidlwsynaellvalenqhtidltdaemnklfe
ktrrqlrenaedmgggcfkiyhkcdnacigsirngtydhyiyrdealnnrfq

SCOPe Domain Coordinates for d4uo1f_:

Click to download the PDB-style file with coordinates for d4uo1f_.
(The format of our PDB-style files is described here.)

Timeline for d4uo1f_: