Class b: All beta proteins [48724] (176 folds) |
Fold b.19: Viral protein domain [49817] (1 superfamily) sandwich; 9 strands in 2 sheets; jelly-roll; form trimers |
Superfamily b.19.1: Viral protein domain [49818] (4 families) forms homotrimers |
Family b.19.1.2: Influenza hemagglutinin headpiece [49823] (2 proteins) |
Protein automated matches [190291] (24 species) not a true protein |
Species Influenza a virus (a/equine/richmond/1/2007)(h3n8)) [TaxId:560387] [258558] (2 PDB entries) |
Domain d4uo1e_: 4uo1 E: [259038] Other proteins in same PDB: d4uo1b_, d4uo1d_, d4uo1f_ automated match to d3hmga_ complexed with fuc, nag |
PDB Entry: 4uo1 (more details), 3 Å
SCOPe Domain Sequences for d4uo1e_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4uo1e_ b.19.1.2 (E:) automated matches {Influenza a virus (a/equine/richmond/1/2007)(h3n8)) [TaxId: 560387]} sqnpisnnntatlclghhavangtlvktisddqievtnatelvqsismgkicnnsyrild grnctlidamlgdphcdvfqyenwdlfierssafsncypydipdyaslrsivassgtlef taegftwtgvtqngrsgackrgsadsffsrlnwltksgnsyptlnvtmpnnknfdklyiw gihhpssnqeqtklyiqesgrvtvstkrsqqtiipnigsrpwvrgqsgrisiywtivkpg dilminsngnlvaprgyfklktgkssvmrsdvpidicvsecitpngsisnekpfqnvnkv tygkcpkyirqntlklatgmrnvpe
Timeline for d4uo1e_: