Lineage for d4uo1e_ (4uo1 E:)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1531182Fold b.19: Viral protein domain [49817] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll; form trimers
  4. 1531183Superfamily b.19.1: Viral protein domain [49818] (4 families) (S)
    forms homotrimers
  5. 1531228Family b.19.1.2: Influenza hemagglutinin headpiece [49823] (2 proteins)
  6. 1531574Protein automated matches [190291] (23 species)
    not a true protein
  7. 1531582Species Influenza a virus (a/equine/richmond/1/2007)(h3n8)) [TaxId:560387] [258558] (1 PDB entry)
  8. 1531584Domain d4uo1e_: 4uo1 E: [259038]
    Other proteins in same PDB: d4uo1f_
    automated match to d3hmga_
    complexed with fuc, nag

Details for d4uo1e_

PDB Entry: 4uo1 (more details), 3 Å

PDB Description: structure of the a_equine_richmond_07 h3 haemagglutinin in complex with 3sln
PDB Compounds: (E:) Hemagglutinin

SCOPe Domain Sequences for d4uo1e_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4uo1e_ b.19.1.2 (E:) automated matches {Influenza a virus (a/equine/richmond/1/2007)(h3n8)) [TaxId: 560387]}
sqnpisnnntatlclghhavangtlvktisddqievtnatelvqsismgkicnnsyrild
grnctlidamlgdphcdvfqyenwdlfierssafsncypydipdyaslrsivassgtlef
taegftwtgvtqngrsgackrgsadsffsrlnwltksgnsyptlnvtmpnnknfdklyiw
gihhpssnqeqtklyiqesgrvtvstkrsqqtiipnigsrpwvrgqsgrisiywtivkpg
dilminsngnlvaprgyfklktgkssvmrsdvpidicvsecitpngsisnekpfqnvnkv
tygkcpkyirqntlklatgmrnvpe

SCOPe Domain Coordinates for d4uo1e_:

Click to download the PDB-style file with coordinates for d4uo1e_.
(The format of our PDB-style files is described here.)

Timeline for d4uo1e_: