SCOPe 2.05: Domain d4unzf_: 4unz F:

Lineage for d4unzf_ (4unz F:)

1. Root: SCOPe 2.05

2. Class h: Coiled coil proteins [57942] (7 folds)

3. Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)
   core: trimeric coiled coil

4. Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families)

5. Family h.3.1.1: Influenza hemagglutinin (stalk) [58065] (2 proteins)

6. Protein automated matches [254646] (33 species)
   not a true protein

7. Species Influenza a virus (a/eq/newmarket/93/(h3n8)) [TaxId:159470] [258552] (2 PDB entries)

8. Domain d4unzf_: 4unz F: [259036]
   Other proteins in same PDB: d4unza_, d4unzc_, d4unze_
   automated match to d3vund_
   complexed with nag

Details for d4unzf_

PDB Entry: 4unz, 2.9 Å

PDB Description: structure of the a_equine_newmarket_2_93 h3 haemagglutinin in complex with 6so4-sialyl lewis x

PDB Compounds: (F:) h3 haemagglutinin ha2 chain

SCOPe Domain Sequences for d4unzf_:

Sequence; same for both SEQRES and ATOM records:

>d4unzf_ h.3.1.1 (F:) automated matches {Influenza a virus (a/eq/newmarket/93/(h3n8)) [TaxId: 159470]}
gifgaiagfiengwegmvdgwygfryqnsegtgqaadlkstqaaidqingklnrviertn
ekfhqiekefsevegriqdlekyvedtkidlwsynaellvalenqhtidltdaemnklfe
ktrrqlrenaedmgggcfkiyhkcdnacigsirngtydhyiyrdealnnrfq

Timeline for d4unzf_:

• d4unzf_ first appeared in SCOPe 2.04
  
• d4unzf_ appears in SCOPe 2.06
  
• d4unzf_ appears in the current release, SCOPe 2.08