Class b: All beta proteins [48724] (176 folds) |
Fold b.19: Viral protein domain [49817] (1 superfamily) sandwich; 9 strands in 2 sheets; jelly-roll; form trimers |
Superfamily b.19.1: Viral protein domain [49818] (4 families) forms homotrimers |
Family b.19.1.2: Influenza hemagglutinin headpiece [49823] (2 proteins) |
Protein automated matches [190291] (24 species) not a true protein |
Species Influenza a virus (a/eq/newmarket/93/(h3n8)) [TaxId:159470] [258548] (2 PDB entries) |
Domain d4unze_: 4unz E: [259035] Other proteins in same PDB: d4unzb_, d4unzd_, d4unzf_ automated match to d3hmga_ complexed with nag |
PDB Entry: 4unz (more details), 2.9 Å
SCOPe Domain Sequences for d4unze_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4unze_ b.19.1.2 (E:) automated matches {Influenza a virus (a/eq/newmarket/93/(h3n8)) [TaxId: 159470]} nntatlclghhavangtlvktitddqievtnatelvqsisigkicnnsyrvldgrnctli damlgdphcddfqyenwdlfierssafsncypydipdyaslrsivassgtleftaegftw tgvtqnggsgackrgsadsffsrlnwltksgnsypilnvtmpnnknfdklyiwgihhpss nkeqtklyiqesgrvtvstersqqtvipnigsrpwvrgqsgrisiywtivkpgdilmins ngnlvaprgyfklrtgkssvmrsdalidtcvsecitpngsipndkpfqnvnkitygkcpk yirqntlklatgmrnvpe
Timeline for d4unze_: