Lineage for d4unze_ (4unz E:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1778087Fold b.19: Viral protein domain [49817] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll; form trimers
  4. 1778088Superfamily b.19.1: Viral protein domain [49818] (4 families) (S)
    forms homotrimers
  5. 1778135Family b.19.1.2: Influenza hemagglutinin headpiece [49823] (2 proteins)
  6. 1778497Protein automated matches [190291] (24 species)
    not a true protein
  7. 1778515Species Influenza a virus (a/eq/newmarket/93/(h3n8)) [TaxId:159470] [258548] (2 PDB entries)
  8. 1778521Domain d4unze_: 4unz E: [259035]
    Other proteins in same PDB: d4unzb_, d4unzd_, d4unzf_
    automated match to d3hmga_
    complexed with nag

Details for d4unze_

PDB Entry: 4unz (more details), 2.9 Å

PDB Description: structure of the a_equine_newmarket_2_93 h3 haemagglutinin in complex with 6so4-sialyl lewis x
PDB Compounds: (E:) hay subunit of haemagglutinin

SCOPe Domain Sequences for d4unze_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4unze_ b.19.1.2 (E:) automated matches {Influenza a virus (a/eq/newmarket/93/(h3n8)) [TaxId: 159470]}
nntatlclghhavangtlvktitddqievtnatelvqsisigkicnnsyrvldgrnctli
damlgdphcddfqyenwdlfierssafsncypydipdyaslrsivassgtleftaegftw
tgvtqnggsgackrgsadsffsrlnwltksgnsypilnvtmpnnknfdklyiwgihhpss
nkeqtklyiqesgrvtvstersqqtvipnigsrpwvrgqsgrisiywtivkpgdilmins
ngnlvaprgyfklrtgkssvmrsdalidtcvsecitpngsipndkpfqnvnkitygkcpk
yirqntlklatgmrnvpe

SCOPe Domain Coordinates for d4unze_:

Click to download the PDB-style file with coordinates for d4unze_.
(The format of our PDB-style files is described here.)

Timeline for d4unze_: