Lineage for d4u0rc2 (4u0r C:112-217)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2754035Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2754036Protein automated matches [190740] (31 species)
    not a true protein
  7. 2759478Species Mouse (Mus musculus) [TaxId:10090] [188198] (836 PDB entries)
  8. 2760517Domain d4u0rc2: 4u0r C:112-217 [259034]
    Other proteins in same PDB: d4u0rb_
    automated match to d1h3pl2

Details for d4u0rc2

PDB Entry: 4u0r (more details), 2.3 Å

PDB Description: plasmodium falciparum reticulocyte-binding protein homologue 5 (pfrh5) bound to monoclonal antibody 9ad4
PDB Compounds: (C:) Monoclonal antibody 9AD4 light chain

SCOPe Domain Sequences for d4u0rc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4u0rc2 b.1.1.0 (C:112-217) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd
skdstysmsstltltkdeyerhnsytceathktstspivksfnrne

SCOPe Domain Coordinates for d4u0rc2:

Click to download the PDB-style file with coordinates for d4u0rc2.
(The format of our PDB-style files is described here.)

Timeline for d4u0rc2:

View in 3D
Domains from same chain:
(mouse over for more information)
d4u0rc1
View in 3D
Domains from other chains:
(mouse over for more information)
d4u0rb_