SCOPe 2.08: Domain d4u1gf2: 4u1g F:112-215

Lineage for d4u1gf2 (4u1g F:112-215)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein automated matches [190374] (15 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [224855] (650 PDB entries)

8. Domain d4u1gf2: 4u1g F:112-215 [259032]
   Other proteins in same PDB: d4u1gb_, d4u1gc1, d4u1ge_, d4u1gf1
   automated match to d1tqbc2

Details for d4u1gf2

PDB Entry: 4u1g, 3.1 Å

PDB Description: plasmodium falciparum reticulocyte-binding protein homologue 5 (pfrh5) bound to monoclonal antibody qa1

PDB Compounds: (F:) QA1 monoclonal antibody light chain

SCOPe Domain Sequences for d4u1gf2:

Sequence; same for both SEQRES and ATOM records:

>d4u1gf2 b.1.1.2 (F:112-215) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd
skdstysmsstltltkdeyerhnsytceathktstspivksfnr

Timeline for d4u1gf2:

• d4u1gf2 first appeared in SCOPe 2.04
  
• d4u1gf2 appears in SCOPe 2.07