SCOPe 2.06: Domain d1c5sa_: 1c5s A:

Lineage for d1c5sa_ (1c5s A:)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
   barrel, closed; n=6, S=8; greek-key
   duplication: consists of two domains of the same fold

4. Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families)

5. Family b.47.1.2: Eukaryotic proteases [50514] (49 proteins)

6. Protein Trypsin(ogen) [50515] (9 species)

7. Species Cow (Bos taurus) [TaxId:9913] [50516] (418 PDB entries)
   Uniprot P00760

8. Domain d1c5sa_: 1c5s A: [25903]
   complexed with ca, esx, so4

Details for d1c5sa_

PDB Entry: 1c5s, 1.36 Å

PDB Description: structural basis for selectivity of a small molecule, s1-binding, sub- micromolar inhibitor of urokinase type plasminogen activator

PDB Compounds: (A:) protein (trypsin)

SCOPe Domain Sequences for d1c5sa_:

Sequence; same for both SEQRES and ATOM records:

>d1c5sa_ b.47.1.2 (A:) Trypsin(ogen) {Cow (Bos taurus) [TaxId: 9913]}
ivggytcgantvpyqvslnsgyhfcggslinsqwvvsaahcyksgiqvrlgedninvveg
neqfisasksivhpsynsntlnndimliklksaaslnsrvasislptscasagtqclisg
wgntkssgtsypdvlkclkapilsdsscksaypgqitsnmfcagyleggkdscqgdsggp
vvcsgklqgivswgsgcaqknkpgvytkvcnyvswikqtiasn

Timeline for d1c5sa_:

• d1c5sa_ first appeared (with stable ids) in SCOP 1.55
  
• d1c5sa_ appears in SCOPe 2.05
  
• d1c5sa_ appears in SCOPe 2.07
  
• d1c5sa_ appears in the current release, SCOPe 2.08