Lineage for d2ru3a_ (2ru3 A:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1906287Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 1908438Superfamily d.58.7: RNA-binding domain, RBD [54928] (6 families) (S)
  5. 1908439Family d.58.7.1: Canonical RBD [54929] (68 proteins)
  6. 1908891Protein automated matches [190332] (4 species)
    not a true protein
  7. 1908954Species Nematode (Caenorhabditis elegans) [TaxId:6239] [258944] (3 PDB entries)
  8. 1908956Domain d2ru3a_: 2ru3 A: [259025]
    automated match to d2cqda1
    protein/RNA complex

Details for d2ru3a_

PDB Entry: 2ru3 (more details)

PDB Description: solution structure of c.elegans sup-12 rrm in complex with rna
PDB Compounds: (A:) Protein SUP-12, isoform a

SCOPe Domain Sequences for d2ru3a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ru3a_ d.58.7.1 (A:) automated matches {Nematode (Caenorhabditis elegans) [TaxId: 6239]}
gstnaepvvgsrdtmftkifvgglpyhtsdktlheyfeqfgdieeavvitdrntqksrgy
gfvtmkdrasaerackdpnpiidgrkanvnlaylgakprtnvq

SCOPe Domain Coordinates for d2ru3a_:

Click to download the PDB-style file with coordinates for d2ru3a_.
(The format of our PDB-style files is described here.)

Timeline for d2ru3a_: