SCOPe 2.04: Domain d2ru3a_: 2ru3 A:

Lineage for d2ru3a_ (2ru3 A:)

1. Root: SCOPe 2.04

2. Class d: Alpha and beta proteins (a+b) [53931] (380 folds)

3. Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.7: RNA-binding domain, RBD [54928] (6 families)

5. Family d.58.7.1: Canonical RBD [54929] (68 proteins)

6. Protein automated matches [190332] (3 species)
   not a true protein

7. Species Caenorhabditis elegans [TaxId:6239] [258944] (3 PDB entries)

8. Domain d2ru3a_: 2ru3 A: [259025]
   automated match to d2cqda1
   protein/RNA complex

Details for d2ru3a_

PDB Entry: 2ru3

PDB Description: solution structure of c.elegans sup-12 rrm in complex with rna

PDB Compounds: (A:) Protein SUP-12, isoform a

SCOPe Domain Sequences for d2ru3a_:

Sequence; same for both SEQRES and ATOM records:

>d2ru3a_ d.58.7.1 (A:) automated matches {Caenorhabditis elegans [TaxId: 6239]}
gstnaepvvgsrdtmftkifvgglpyhtsdktlheyfeqfgdieeavvitdrntqksrgy
gfvtmkdrasaerackdpnpiidgrkanvnlaylgakprtnvq

Timeline for d2ru3a_:

• d2ru3a_ is new in SCOPe 2.04-stable
  
• d2ru3a_ appears in SCOPe 2.05
  
• d2ru3a_ appears in the current release, SCOPe 2.08, called d2ru3a1