![]() | Class d: Alpha and beta proteins (a+b) [53931] (380 folds) |
![]() | Fold d.58: Ferredoxin-like [54861] (59 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
![]() | Superfamily d.58.7: RNA-binding domain, RBD [54928] (6 families) ![]() |
![]() | Family d.58.7.1: Canonical RBD [54929] (68 proteins) |
![]() | Protein automated matches [190332] (3 species) not a true protein |
![]() | Species Caenorhabditis elegans [TaxId:6239] [258944] (3 PDB entries) |
![]() | Domain d2ru3a_: 2ru3 A: [259025] automated match to d2cqda1 protein/RNA complex |
PDB Entry: 2ru3 (more details)
SCOPe Domain Sequences for d2ru3a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ru3a_ d.58.7.1 (A:) automated matches {Caenorhabditis elegans [TaxId: 6239]} gstnaepvvgsrdtmftkifvgglpyhtsdktlheyfeqfgdieeavvitdrntqksrgy gfvtmkdrasaerackdpnpiidgrkanvnlaylgakprtnvq
Timeline for d2ru3a_: