SCOP 1.71: Domain d1c5ua_: 1c5u A:

Lineage for d1c5ua_ (1c5u A:)

1. Root: SCOP 1.71

2. Class b: All beta proteins [48724] (149 folds)

3. Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
   barrel, closed; n=6, S=8; greek-key
   duplication: consists of two domains of the same fold

4. Superfamily b.47.1: Trypsin-like serine proteases [50494] (4 families)

5. Family b.47.1.2: Eukaryotic proteases [50514] (47 proteins)

6. Protein Trypsin(ogen) [50515] (8 species)

7. Species Cow (Bos taurus) [TaxId:9913] [50516] (229 PDB entries)

8. Domain d1c5ua_: 1c5u A: [25902]
   complexed with ca, esp, mg, so4

Details for d1c5ua_

PDB Entry: 1c5u, 1.37 Å

PDB Description: structural basis for selectivity of a small molecule, s1-binding, sub- micromolar inhibitor of urokinase type plasminogen activator

SCOP Domain Sequences for d1c5ua_:

Sequence; same for both SEQRES and ATOM records:

>d1c5ua_ b.47.1.2 (A:) Trypsin(ogen) {Cow (Bos taurus)}
ivggytcgantvpyqvslnsgyhfcggslinsqwvvsaahcyksgiqvrlgedninvveg
neqfisasksivhpsynsntlnndimliklksaaslnsrvasislptscasagtqclisg
wgntkssgtsypdvlkclkapilsdsscksaypgqitsnmfcagyleggkdscqgdsggp
vvcsgklqgivswgsgcaqknkpgvytkvcnyvswikqtiasn

Timeline for d1c5ua_:

• d1c5ua_ first appeared (with stable ids) in SCOP 1.55
  
• d1c5ua_ appears in SCOP 1.69
  
• d1c5ua_ appears in SCOP 1.73
  
• d1c5ua_ appears in the current release, SCOPe 2.08