SCOP 1.73: Domain d1c1pa_: 1c1p A:

Lineage for d1c1pa_ (1c1p A:)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
   barrel, closed; n=6, S=8; greek-key
   duplication: consists of two domains of the same fold

4. Superfamily b.47.1: Trypsin-like serine proteases [50494] (4 families)

5. Family b.47.1.2: Eukaryotic proteases [50514] (47 proteins)

6. Protein Trypsin(ogen) [50515] (9 species)

7. Species Cow (Bos taurus) [TaxId:9913] [50516] (271 PDB entries)

8. Domain d1c1pa_: 1c1p A: [25900]
   complexed with bai, ca, dms, mg, so4

Details for d1c1pa_

PDB Entry: 1c1p, 1.37 Å

PDB Description: recruiting zinc to mediate potent, specific inhibition of serine proteases

PDB Compounds: (A:) Trypsin

SCOP Domain Sequences for d1c1pa_:

Sequence; same for both SEQRES and ATOM records:

>d1c1pa_ b.47.1.2 (A:) Trypsin(ogen) {Cow (Bos taurus) [TaxId: 9913]}
ivggytcgantvpyqvslnsgyhfcggslinsqwvvsaahcyksgiqvrlgedninvveg
neqfisasksivhpsynsntlnndimliklksaaslnsrvasislptscasagtqclisg
wgntkssgtsypdvlkclkapilsdsscksaypgqitsnmfcagyleggkdscqgdsggp
vvcsgklqgivswgsgcaqknkpgvytkvcnyvswikqtiasn

Timeline for d1c1pa_:

• d1c1pa_ first appeared (with stable ids) in SCOP 1.55
  
• d1c1pa_ appears in SCOP 1.71
  
• d1c1pa_ appears in SCOP 1.75
  
• d1c1pa_ appears in the current release, SCOPe 2.08