SCOPe 2.08: Domain d4qseb_: 4qse B:

Lineage for d4qseb_ (4qse B:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
   consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
   mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest

4. Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families)
   Similar in architecture to the superfamily I but partly differs in topology

5. Family c.94.1.0: automated matches [191309] (1 protein)
   not a true family

6. Protein automated matches [190039] (161 species)
   not a true protein

7. Species Agrobacterium fabrum [TaxId:176299] [258501] (12 PDB entries)

8. Domain d4qseb_: 4qse B: [258992]
   automated match to d1fqba_
   complexed with gol

Details for d4qseb_

PDB Entry: 4qse, 1.37 Å

PDB Description: crystal structure of atu4361 sugar transporter from agrobacterium fabrum c58, target efi-510558, with bound glycerol

PDB Compounds: (B:) abc-type sugar transporter

SCOPe Domain Sequences for d4qseb_:

Sequence; same for both SEQRES and ATOM records:

>d4qseb_ c.94.1.0 (B:) automated matches {Agrobacterium fabrum [TaxId: 176299]}
dvtltlwsldrdiqpapnlikefnalnngikieyrqlqfddvvsesmraystgnapdiia
idnpnhamfasrgafldvtdmiaksdviktenyfpgplksvtwdgkyfgvpkatntialy
ynkdlfkaagldaakppqtwdelvdaarkltnpaknvygisfsakaneegtfqflpwaqm
agatyknintdgavkaletwktlldeklaspdtltrsqwdstatfnagnaamaisgpwei
drmlkdakfdwgvtllpvptpdaprssamgdynwaifsktkhpaeafkaieffaskdkdm
fknfgqlparsdipvpptgnalkdealktfveqlkyaqprgpspewpkiskaiqdaiqga
lsgqmtpkaaldqaaekiklvd

Timeline for d4qseb_:

• d4qseb_ first appeared in SCOPe 2.04
  
• d4qseb_ appears in SCOPe 2.07