![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.6: Cupredoxin-like [49502] (2 superfamilies) sandwich; 7 strands in 2 sheets, greek-key variations: some members have additional 1-2 strands |
![]() | Superfamily b.6.1: Cupredoxins [49503] (8 families) ![]() contains copper-binding site |
![]() | Family b.6.1.1: Plastocyanin/azurin-like [49504] (10 proteins) mono-domain proteins |
![]() | Protein Azurin [49530] (6 species) |
![]() | Species Pseudomonas aeruginosa [TaxId:287] [49533] (96 PDB entries) Uniprot P00282 |
![]() | Domain d4qlwb_: 4qlw B: [258988] automated match to d1etja_ complexed with fe, no3, so4; mutant |
PDB Entry: 4qlw (more details), 2 Å
SCOPe Domain Sequences for d4qlwb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4qlwb_ b.6.1.1 (B:) Azurin {Pseudomonas aeruginosa [TaxId: 287]} aecsvdiqgndqmqfntnaitvdksckqftvnlshpgnlpknvmghnwvlstaadmqgvv tdgmasgldkdylkpddsrviahtkligsgekdsvtfdvsklkegeqymffctfpghsal ekgtltlk
Timeline for d4qlwb_: