Lineage for d4qacb1 (4qac B:1-205)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2819475Fold b.96: Nicotinic receptor ligand binding domain-like [63711] (1 superfamily)
    sandwich; 8 strands in 2 sheets; greek-key: partial topological similarity to immunoglobulin-like folds
  4. 2819476Superfamily b.96.1: Nicotinic receptor ligand binding domain-like [63712] (2 families) (S)
  5. 2819477Family b.96.1.1: Nicotinic receptor ligand binding domain-like [63713] (2 proteins)
    automatically mapped to Pfam PF02931
  6. 2819576Protein automated matches [190922] (2 species)
    not a true protein
  7. 2819577Species Great pond snail (Lymnaea stagnalis) [TaxId:6523] [190008] (38 PDB entries)
  8. 2819639Domain d4qacb1: 4qac B:1-205 [258984]
    Other proteins in same PDB: d4qaca2, d4qacb2, d4qacc2, d4qacd2, d4qace2, d4qacf2, d4qacg2, d4qach2, d4qaci2, d4qacj2
    automated match to d4alxa_
    complexed with kk3, nag, po4

Details for d4qacb1

PDB Entry: 4qac (more details), 2.1 Å

PDB Description: x-ray structure of acetylcholine binding protein (achbp) in complex with 4-(4-methylpiperidin-1-yl)-6-(4-(trifluoromethyl)phenyl) pyrimidin-2-amine
PDB Compounds: (B:) acetylcholine-binding protein

SCOPe Domain Sequences for d4qacb1:

Sequence, based on SEQRES records: (download)

>d4qacb1 b.96.1.1 (B:1-205) automated matches {Great pond snail (Lymnaea stagnalis) [TaxId: 6523]}
ldradilynirqtsrpdviptqrdrpvavsvslkfinilevneitnevdvvfwqqttwsd
rtlawnsshspdqvsvpisslwvpdlaaynaiskpevltpqlarvvsdgevlympsirqr
fscdvsgvdtesgatcrikigswthhsreisvdpttensddseyfsqysrfeildvtqkk
nsvtysccpeayedvevslnfrkkg

Sequence, based on observed residues (ATOM records): (download)

>d4qacb1 b.96.1.1 (B:1-205) automated matches {Great pond snail (Lymnaea stagnalis) [TaxId: 6523]}
ldradilynirqtsrpdviptqrdrpvavsvslkfinilevneitnevdvvfwqqttwsd
rtlawnsshspdqvsvpisslwvpdlaaynaiskpevltpqlarvvsdgevlympsirqr
fscdvsgvdtesgatcrikigswthhsreisvdpttsddseyfsqysrfeildvtqkkns
vtysccpeayedvevslnfrkkg

SCOPe Domain Coordinates for d4qacb1:

Click to download the PDB-style file with coordinates for d4qacb1.
(The format of our PDB-style files is described here.)

Timeline for d4qacb1: