Lineage for d4phja_ (4phj A:)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1733371Fold a.39: EF Hand-like [47472] (4 superfamilies)
    core: 4 helices; array of 2 hairpins, opened
  4. 1733372Superfamily a.39.1: EF-hand [47473] (12 families) (S)
    Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop
  5. 1734551Family a.39.1.8: Penta-EF-hand proteins [63550] (7 proteins)
  6. 1734565Protein Calpain small (regulatory) subunit (domain VI) [47552] (3 species)
  7. 1734566Species Human (Homo sapiens) [TaxId:9606] [47553] (8 PDB entries)
  8. 1734567Domain d4phja_: 4phj A: [258978]
    automated match to d1kfxs_
    complexed with ca

Details for d4phja_

PDB Entry: 4phj (more details), 1.6 Å

PDB Description: The Structural Basis of Differential Inhibition of Human Calpain by Indole and Phenyl alpha-Mercaptoacrylic Acids: Human unliganded protein
PDB Compounds: (A:) Calpain small subunit 1

SCOPe Domain Sequences for d4phja_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4phja_ a.39.1.8 (A:) Calpain small (regulatory) subunit (domain VI) {Human (Homo sapiens) [TaxId: 9606]}
eevrqfrrlfaqlagddmevsatelmnilnkvvtrhpdlktdgfgidtcrsmvavmdsdt
tgklgfeefkylwnnikrwqaiykqfdtdrsgticsselpgafeaagfhlnehlynmiir
rysdesgnmdfdnfisclvrldamfrafksldkdgtgqiqvniqewlqltmys

SCOPe Domain Coordinates for d4phja_:

Click to download the PDB-style file with coordinates for d4phja_.
(The format of our PDB-style files is described here.)

Timeline for d4phja_: