SCOPe 2.04: Domain d4p2cd_: 4p2c D:

Lineage for d4p2cd_ (4p2c D:)

1. Root: SCOPe 2.04

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.40: OB-fold [50198] (16 superfamilies)
   barrel, closed or partly opened n=5, S=10 or S=8; greek-key

4. Superfamily b.40.2: Bacterial enterotoxins [50203] (3 families)

5. Family b.40.2.1: Bacterial AB5 toxins, B-subunits [50204] (7 proteins)

6. Protein automated matches [190381] (4 species)
   not a true protein

7. Species Escherichia coli [TaxId:562] [187229] (7 PDB entries)

8. Domain d4p2cd_: 4p2c D: [258976]
   Other proteins in same PDB: d4p2ch_
   automated match to d2bosa_

Details for d4p2cd_

PDB Entry: 4p2c, 2.82 Å

PDB Description: complex of shiga toxin 2e with a neutralizing single-domain antibody

PDB Compounds: (D:) Shiga toxin 2e, subunit B

SCOPe Domain Sequences for d4p2cd_:

Sequence; same for both SEQRES and ATOM records:

>d4p2cd_ b.40.2.1 (D:) automated matches {Escherichia coli [TaxId: 562]}
adcakgkiefskynedntftvkvsgreywtnrwnlqpllqsaqltgmtvtiisntcssgs
gfaqvkfn

Timeline for d4p2cd_:

• d4p2cd_ is new in SCOPe 2.04-stable
  
• d4p2cd_ appears in SCOPe 2.05
  
• d4p2cd_ appears in the current release, SCOPe 2.08