Lineage for d4ozeb2 (4oze B:128-268)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2930059Fold d.14: Ribosomal protein S5 domain 2-like [54210] (1 superfamily)
    core: beta(3)-alpha-beta-alpha; 2 layers: alpha/beta; left-handed crossover
  4. 2930060Superfamily d.14.1: Ribosomal protein S5 domain 2-like [54211] (13 families) (S)
  5. 2930643Family d.14.1.7: UDP-3-O-[3-hydroxymyristoyl] N-acetylglucosamine deacetylase LpxC [89827] (2 proteins)
    duplication; there are two structural repeats of this fold; each repeat is elaborated with additional structures forming the active site
  6. 2930644Protein UDP-3-O-[3-hydroxymyristoyl] N-acetylglucosamine deacetylase LpxC [89828] (1 species)
  7. 2930645Species Aquifex aeolicus [TaxId:63363] [89829] (18 PDB entries)
    Uniprot O67648 3-270
  8. 2930655Domain d4ozeb2: 4oze B:128-268 [258972]
    automated match to d1xxea2
    complexed with 24g, cl, zn

Details for d4ozeb2

PDB Entry: 4oze (more details), 1.61 Å

PDB Description: A.aolicus LpxC in complex with native product
PDB Compounds: (B:) UDP-3-O-[3-hydroxymyristoyl] N-acetylglucosamine deacetylase

SCOPe Domain Sequences for d4ozeb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4ozeb2 d.14.1.7 (B:128-268) UDP-3-O-[3-hydroxymyristoyl] N-acetylglucosamine deacetylase LpxC {Aquifex aeolicus [TaxId: 63363]}
epiivedegrlikaepsdtlevtyegefknflgrqkftfvegneeeivlartfcfdweie
hikkvglgkggslkntlvlgkdkvynpeglryenepvrhkvfdligdlyllgspvkgkfy
sfrgghslnvklvkelakkqk

SCOPe Domain Coordinates for d4ozeb2:

Click to download the PDB-style file with coordinates for d4ozeb2.
(The format of our PDB-style files is described here.)

Timeline for d4ozeb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d4ozeb1