SCOPe 2.01: Domain d1xuha_: 1xuh A:

Lineage for d1xuha_ (1xuh A:)

1. Root: SCOPe 2.01

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
   barrel, closed; n=6, S=8; greek-key
   duplication: consists of two domains of the same fold

4. Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families)

5. Family b.47.1.2: Eukaryotic proteases [50514] (48 proteins)

6. Protein Trypsin(ogen) [50515] (9 species)

7. Species Cow (Bos taurus) [TaxId:9913] [50516] (340 PDB entries)
   Uniprot P00760

8. Domain d1xuha_: 1xuh A: [25897]
   complexed with bao, ca, co, so4

Details for d1xuha_

PDB Entry: 1xuh, 2.2 Å

PDB Description: trypsin-keto-babim-co+2, ph 8.2

PDB Compounds: (A:) Trypsin

SCOPe Domain Sequences for d1xuha_:

Sequence; same for both SEQRES and ATOM records:

>d1xuha_ b.47.1.2 (A:) Trypsin(ogen) {Cow (Bos taurus) [TaxId: 9913]}
ivggytcgantvpyqvslnsgyhfcggslinsqwvvsaahcyksgiqvrlgedninvveg
neqfisasksivhpsynsntlnndimliklksaaslnsrvasislptscasagtqclisg
wgntkssgtsypdvlkclkapilsdsscksaypgqitsnmfcagyleggkdscqgdsggp
vvcsgklqgivswgsgcaqknkpgvytkvcnyvswikqtiasn

Timeline for d1xuha_:

• d1xuha_ first appeared (with stable ids) in SCOP 1.55, called d1xuh__
  
• d1xuha_ appears in SCOP 1.75
  
• d1xuha_ appears in SCOPe 2.02
  
• d1xuha_ appears in the current release, SCOPe 2.08