Lineage for d4ow1s_ (4ow1 S:)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1632226Fold d.2: Lysozyme-like [53954] (1 superfamily)
    common alpha+beta motif for the active site region
  4. 1632227Superfamily d.2.1: Lysozyme-like [53955] (12 families) (S)
  5. 1634020Family d.2.1.0: automated matches [191411] (1 protein)
    not a true family
  6. 1634021Protein automated matches [190563] (11 species)
    not a true protein
  7. 1634041Species Mycobacterium tuberculosis [TaxId:1773] [236519] (2 PDB entries)
  8. 1634043Domain d4ow1s_: 4ow1 S: [258968]
    automated match to d4emna_
    complexed with edo

Details for d4ow1s_

PDB Entry: 4ow1 (more details), 1.9 Å

PDB Description: crystal structure of resuscitation promoting factor c
PDB Compounds: (S:) Resuscitation-promoting factor RpfC

SCOPe Domain Sequences for d4ow1s_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4ow1s_ d.2.1.0 (S:) automated matches {Mycobacterium tuberculosis [TaxId: 1773]}
gpspnwdavaqcesggnwaantgngkygglqfkpatwaafggvgnpaaasreqqiavanr
vlaeqgldawptcgaasglpialwsk

SCOPe Domain Coordinates for d4ow1s_:

Click to download the PDB-style file with coordinates for d4ow1s_.
(The format of our PDB-style files is described here.)

Timeline for d4ow1s_: