SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d4oqnb_ (4oqn B:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2109203Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2109204Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) (S)
    division into families based on beta-sheet topologies
  5. 2109205Family c.37.1.1: Nucleotide and nucleoside kinases [52541] (21 protein domains)
    parallel beta-sheet of 5 strands, order 23145
  6. 2109585Protein Thymidine kinase [52552] (4 species)
    contains insert all-alpha subdomain, res. 251-322
  7. 2109599Species Herpes simplex virus type 1, different strains [TaxId:10298] [52553] (33 PDB entries)
    Uniprot P03176 46-375
  8. 2109653Domain d4oqnb_: 4oqn B: [258963]
    automated match to d1p7cb_
    protein/DNA complex; complexed with edu, so4

Details for d4oqnb_

PDB Entry: 4oqn (more details), 2.3 Å

PDB Description: Crystal structure of thymidine kinase from herpes simplex virus type 1 in complex with EdU
PDB Compounds: (B:) Thymidine kinase

SCOPe Domain Sequences for d4oqnb_:

Sequence, based on SEQRES records: (download)

>d4oqnb_ c.37.1.1 (B:) Thymidine kinase {Herpes simplex virus type 1, different strains [TaxId: 10298]}
mptllrvyidgphgmgkttttqllvalgsrddivyvpepmtywrvlgasetianiyttqh
rldqgeisagdaavvmtsaqitmgmpyavtdavlaphiggeagsshapppaltlifdrhp
iaallcypaarylmgsmtpqavlafvalipptlpgtnivlgalpedrhidrlakrqrpge
rldlamlaairrvygllantvrylqcggswredwgqlsgtavppqgaepqsnagprphig
dtlftlfrapellapngdlynvfawaldvlakrlrsmhvfildydqspagcrdallqlts
gmvqthvttpgsipticdlartfaremge

Sequence, based on observed residues (ATOM records): (download)

>d4oqnb_ c.37.1.1 (B:) Thymidine kinase {Herpes simplex virus type 1, different strains [TaxId: 10298]}
mptllrvyidgphgmgkttttqllvalgsrddivyvpepmtywrvlgasetianiyttqh
rldqgeisagdaavvmtsaqitmgmpyavtdavlaphiggeapppaltlifdrhpiaall
cypaarylmgsmtpqavlafvalipptlpgtnivlgalpedrhidrlakrqrpgerldla
mlaairrvygllantvrylqcggswredwgqlsgpqsnagprphigdtlftlfrapella
pngdlynvfawaldvlakrlrsmhvfildydqspagcrdallqltsgmvqthvttpgsip
ticdlartfaremge

SCOPe Domain Coordinates for d4oqnb_:

Click to download the PDB-style file with coordinates for d4oqnb_.
(The format of our PDB-style files is described here.)

Timeline for d4oqnb_: