Lineage for d4nz2a1 (4nz2 A:29-490)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2004931Fold a.104: Cytochrome P450 [48263] (1 superfamily)
    multihelical
  4. 2004932Superfamily a.104.1: Cytochrome P450 [48264] (2 families) (S)
  5. 2004933Family a.104.1.1: Cytochrome P450 [48265] (23 protein domains)
  6. 2005388Protein Mammalian cytochrome p450 2c9 [89118] (1 species)
  7. 2005389Species Human (Homo sapiens) [TaxId:9606] [89119] (4 PDB entries)
    Uniprot P11712
  8. 2005395Domain d4nz2a1: 4nz2 A:29-490 [258951]
    Other proteins in same PDB: d4nz2a2, d4nz2b2
    automated match to d1og5a_
    complexed with 2qj, gol, hem, so4

Details for d4nz2a1

PDB Entry: 4nz2 (more details), 2.45 Å

PDB Description: Crystal structure of CYP2C9 in complex with an inhibitor
PDB Compounds: (A:) Cytochrome P450 2C9

SCOPe Domain Sequences for d4nz2a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4nz2a1 a.104.1.1 (A:29-490) Mammalian cytochrome p450 2c9 {Human (Homo sapiens) [TaxId: 9606]}
rppgptplpvignilqigikdisksltnlskvygpvftlyfglkpivvlhgyeavkeali
dlgeefsgrgifplaeranrgfgivfsngkkwkeirrfslmtlrnfgmgkrsiedrvqee
arclveelrktkaspcdptfilgcapcnvicsiifhkrfdykdqqflnlmeklnenieil
sspwiqvynnfpalldyfpgthnkllknvafmksyilekvkehqesmdmnnpqdfidcfl
mkmekekhnqpseftieslentavdlfgagtettsttlryalllllkhpevtakvqeeie
rvigrnrspcmqdrshmpytdavvhevqryidllptslphavtcdikfrnylipkgttil
isltsvlhdnkefpnpemfdphhfldeggnfkkskyfmpfsagkricvgealagmelflf
ltsilqnfnlkslvdpknldttpvvngfasvppfyqlcfipv

SCOPe Domain Coordinates for d4nz2a1:

Click to download the PDB-style file with coordinates for d4nz2a1.
(The format of our PDB-style files is described here.)

Timeline for d4nz2a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4nz2a2