SCOPe 2.06: Domain d2mgzb1: 2mgz B:20-123

Lineage for d2mgzb1 (2mgz B:20-123)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.7: RNA-binding domain, RBD [54928] (6 families)

5. Family d.58.7.1: Canonical RBD [54929] (68 proteins)

6. Protein automated matches [190332] (5 species)
   not a true protein

7. Species Nematode (Caenorhabditis elegans) [TaxId:6239] [258944] (3 PDB entries)

8. Domain d2mgzb1: 2mgz B:20-123 [258945]
   Other proteins in same PDB: d2mgza1, d2mgza2, d2mgzb2
   automated match to d2cqda1
   protein/RNA complex

Details for d2mgzb1

PDB Entry: 2mgz

PDB Description: solution structure of rbfox family asd-1 rrm and sup-12 rrm in ternary complex with rna

PDB Compounds: (B:) Protein SUP-12, isoform a

SCOPe Domain Sequences for d2mgzb1:

Sequence; same for both SEQRES and ATOM records:

>d2mgzb1 d.58.7.1 (B:20-123) automated matches {Nematode (Caenorhabditis elegans) [TaxId: 6239]}
stnaepvvgsrdtmftkifvgglpyhtsdktlheyfeqfgdieeavvitdrntqksrgyg
fvtmkdrasaerackdpnpiidgrkanvnlaylgakprtnvqla

Timeline for d2mgzb1:

• d2mgzb1 first appeared in SCOPe 2.04, called d2mgzb_
  
• d2mgzb1 was called d2mgzb_ in SCOPe 2.05
  
• d2mgzb1 appears in SCOPe 2.07
  
• d2mgzb1 appears in the current release, SCOPe 2.08