SCOPe 2.08: Domain d4m6nl1: 4m6n L:1-112

Lineage for d4m6nl1 (4m6n L:1-112)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein automated matches [190119] (24 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [188740] (709 PDB entries)

8. Domain d4m6nl1: 4m6n L:1-112 [258942]
   Other proteins in same PDB: d4m6nh_, d4m6nl2
   automated match to d1aqkl1
   complexed with fmt

Details for d4m6nl1

PDB Entry: 4m6n, 2 Å

PDB Description: Crystal structure of anti-IL-23 antibody CNTO1959 at pH 6.5

PDB Compounds: (L:) CNTO1959 light chain

SCOPe Domain Sequences for d4m6nl1:

Sequence; same for both SEQRES and ATOM records:

>d4m6nl1 b.1.1.1 (L:1-112) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qsvltqppsvsgapgqrvtisctgsssnigsgydvhwyqqlpgtapklliygnskrpsgv
pdrfsgsksgtsaslaitglqsedeadyycaswtdglslvvfgggtkltvlg

Timeline for d4m6nl1:

• d4m6nl1 first appeared in SCOPe 2.04
  
• d4m6nl1 appears in SCOPe 2.07