Lineage for d1bjv__ (1bjv -)

  1. Root: SCOP 1.57
  2. 51639Class b: All beta proteins [48724] (104 folds)
  3. 60334Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
  4. 60335Superfamily b.47.1: Trypsin-like serine proteases [50494] (4 families) (S)
  5. 60420Family b.47.1.2: Eukaryotic proteases [50514] (35 proteins)
  6. 60859Protein Trypsin(ogen) [50515] (6 species)
  7. 60860Species Cow (Bos taurus) [TaxId:9913] [50516] (128 PDB entries)
  8. 60947Domain d1bjv__: 1bjv - [25894]

Details for d1bjv__

PDB Entry: 1bjv (more details), 1.8 Å

PDB Description: beta-trypsin complexed with appu

SCOP Domain Sequences for d1bjv__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bjv__ b.47.1.2 (-) Trypsin(ogen) {Cow (Bos taurus)}
ivggytcgantvpyqvslnsgyhfcggslinsqwvvsaahcyksgiqvrlgedninvveg
neqfisasksivhpsynsntlnndimliklksaaslnsrvasislptscasagtqclisg
wgntkssgtsypdvlkclkapilsdsscksaypgqitsnmfcagyleggkdscqgdsggp
vvcsgklqgivswgsgcaqknkpgvytkvcnyvswikqtiasn

SCOP Domain Coordinates for d1bjv__:

Click to download the PDB-style file with coordinates for d1bjv__.
(The format of our PDB-style files is described here.)

Timeline for d1bjv__: