![]() | Class d: Alpha and beta proteins (a+b) [53931] (380 folds) |
![]() | Fold d.17: Cystatin-like [54402] (7 superfamilies) Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet |
![]() | Superfamily d.17.5: Uracil-DNA glycosylase inhibitor protein [54441] (1 family) ![]() has an additional strand at the C-terminus and a helix inserted after the first strand |
![]() | Family d.17.5.1: Uracil-DNA glycosylase inhibitor protein [54442] (1 protein) |
![]() | Protein Uracil-DNA glycosylase inhibitor protein [54443] (2 species) |
![]() | Species Bacteriophage pbs2 [TaxId:10684] [54445] (11 PDB entries) |
![]() | Domain d4lyll_: 4lyl L: [258936] Other proteins in same PDB: d4lyla_, d4lylc_, d4lyle_, d4lylg_, d4lyli_, d4lylk_, d4lylm_, d4lylo_ automated match to d1ugia_ protein/DNA complex |
PDB Entry: 4lyl (more details), 1.93 Å
SCOPe Domain Sequences for d4lyll_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4lyll_ d.17.5.1 (L:) Uracil-DNA glycosylase inhibitor protein {Bacteriophage pbs2 [TaxId: 10684]} nlsdiieketgkqlviqesilmlpeeveevignkpesdilvhtaydestdenvmlltsda peykpwalviqdsngenkikml
Timeline for d4lyll_: