Lineage for d4lylm_ (4lyl M:)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1586283Fold c.18: Uracil-DNA glycosylase-like [52140] (1 superfamily)
    3 layers, a/b/a; core: parallel beta-sheet of 4 strands, order 2134
  4. 1586284Superfamily c.18.1: Uracil-DNA glycosylase-like [52141] (5 families) (S)
  5. 1586285Family c.18.1.1: Uracil-DNA glycosylase [52142] (2 proteins)
  6. 1586286Protein Uracil-DNA glycosylase [52143] (5 species)
  7. 1586287Species Atlantic cod (Gadus morhua) [TaxId:8049] [102212] (2 PDB entries)
  8. 1586296Domain d4lylm_: 4lyl M: [258932]
    Other proteins in same PDB: d4lylb_, d4lyld_, d4lylf_, d4lylh_, d4lylj_, d4lyll_, d4lyln_, d4lylp_
    automated match to d1okba_
    protein/DNA complex

Details for d4lylm_

PDB Entry: 4lyl (more details), 1.93 Å

PDB Description: Crystal structure of uracil-DNA glycosylase from cod (Gadus morhua) in complex with the proteinaceous inhibitor UGI
PDB Compounds: (M:) uracil-DNA glycosylase

SCOPe Domain Sequences for d4lylm_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4lylm_ c.18.1.1 (M:) Uracil-DNA glycosylase {Atlantic cod (Gadus morhua) [TaxId: 8049]}
meffgetwrrelaaefekpyfkqlmsfvadersrhtvyppadqvyswtemcdiqdvkvvi
lgqdpyhgpnqahglcfsvqkpvppppslvniykelctdidgfkhpghgdlsgwakqgvl
llnavltvrahqanshkdrgwetftdavikwlsvnregvvfllwgsyahkkgatidrkrh
hvlqavhpsplsahrgflgckhfskangllklsgtepinwral

SCOPe Domain Coordinates for d4lylm_:

Click to download the PDB-style file with coordinates for d4lylm_.
(The format of our PDB-style files is described here.)

Timeline for d4lylm_: